Paralogue Annotation for RYR1 residue 4179

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4179
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4179

No paralogue variants have been mapped to residue 4179 for RYR1.



RYR1LSEHVPHDPRLHNFLELAESILEYFRPYLG>R<IEIMGASRRIERIYFEISETNRAQWEMPQV4209
RYR2LSEHMPNDTRLQTFLELAESVLNYFQPFLG>R<IEIMGSAKRIERVYFEISESSRTQWEKPQV4165
RYR3LSEHMPNDSRLKCLLDPAESVLNYFEPYLG>R<IEIMGGAKKIERVYFEISESSRTQWEKPQV4061
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4179Hc.12536G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Recessive RYR1 mutations cause unusual congenital myopathy with prominent nuclear internalization and large areas of myofibrillar disorganization. Neuropathol Appl Neurobiol. 2011 37(3):271-84. doi: 10.1111/j.1365-2990.2010.01149. 21062345
p.R4179Pc.12536G>C Putative BenignSIFT: deleterious
Polyphen: benign