Paralogue Annotation for RYR1 residue 4200

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4200
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4200

No paralogue variants have been mapped to residue 4200 for RYR1.



RYR1LEYFRPYLGRIEIMGASRRIERIYFEISET>N<RAQWEMPQVKESKRQFIFDVVNEGGEAEKM4230
RYR2LNYFQPFLGRIEIMGSAKRIERVYFEISES>S<RTQWEKPQVKESKRQFIFDVVNEGGEKEKM4186
RYR3LNYFEPYLGRIEIMGGAKKIERVYFEISES>S<RTQWEKPQVKESKRQFIFDVVNEGGEQEKM4082
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N4200Ic.12599A>T Putative BenignSIFT:
Polyphen: benign