Paralogue Annotation for RYR1 residue 4229

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4229
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4229

No paralogue variants have been mapped to residue 4229 for RYR1.



RYR1TNRAQWEMPQVKESKRQFIFDVVNEGGEAE>K<MELFVSFCEDTIFEMQIAAQISEPEGEPET4259
RYR2SSRTQWEKPQVKESKRQFIFDVVNEGGEKE>K<MELFVNFCEDTIFEMQLAAQISESDLNERS4215
RYR3SSRTQWEKPQVKESKRQFIFDVVNEGGEQE>K<MELFVNFCEDTIFEMQLASQISESDSADRP4111
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K4229Nc.12687G>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Clinical and genetic findings in a large cohort of patients with ryanodine receptor 1 gene-associated myopathies. Hum Mutat. 2012 33(6):981-8. doi: 10.1002/humu.22056. 22473935
p.K4229Rc.12686A>G UnknownSIFT:
Polyphen: benign