Paralogue Annotation for RYR1 residue 4282

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4282
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4282

No paralogue variants have been mapped to residue 4282 for RYR1.



RYR1EPEGEPETDEDEGAGAAEAGAEGAEEGAAG>L<EGTAATAAAGATARVVAAAGRALRGLSYRS4312
RYR2ESDLNERSANKEESEK-----ERPEEQGPR>M<AFFSILTVRSALFALRYNILTLMRMLSLKS4263
RYR3ESDSADRPEEEEEDEDSSYVLEIAGEEEED>G<SLEPASAFAMACASVKRNVTDFLKRATLKN4164
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L4282Vc.12844C>G Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Next-generation Sequencing of RYR1 and CACNA1S in Malignant Hyperthermia and Exertional Heat Illness. Anesthesiology. 2015 122(5):1033-46. doi: 10.1097/ALN.0000000000000610. 25658027