Paralogue Annotation for RYR1 residue 429

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 429
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 429

No paralogue variants have been mapped to residue 429 for RYR1.



RYR1AARMIHSTNGLYNQFIKSLDSFSGKPRGSG>P<PAGTALPIEGVILSLQDLIIYFEPPSEDLQ459
RYR2TARVIRSTVFLFNRFIRGLDALSKKAKA-->-<-STVDLPIESVSLSLQDLIGYFHPPDEHLE471
RYR3AARIIRNTTALFSQFVSGN-----NRTA-->-<-APITLPIEEVLQTLQDLIAYFQPPEEEMR458
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P429Lc.1286C>T Putative BenignSIFT:
Polyphen: possibly damaging