Paralogue Annotation for RYR1 residue 4300

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4300
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4300

No paralogue variants have been mapped to residue 4300 for RYR1.



RYR1AGAEGAEEGAAGLEGTAATAAAGATARVVA>A<AGRALRGLSYRSLRRRVRRLRRLTAREAAT4330
RYR2---ERPEEQGPRMAFFSILTVRSALFALRY>N<ILTLMRMLSLKSLKKQMKKVKKMTVKDMVT4281
RYR3YVLEIAGEEEEDGSLEPASAFAMACASVKR>N<VTDFLKRATLKNLRKQYRNVKKMTAKELVK4182
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4300Tc.12898G>A UnknownSIFT:
Polyphen: benign