Paralogue Annotation for RYR1 residue 4532

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4532
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4532

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2G4471RSudden unexplained deathMedium4 24631775

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1KEEVPEPTPEPPKKQ---------APPSPP>P<KKEEAGGEFWGELEVQRVKFLNYLSRNFYT4562
RYR2KEEKAKEDKGKQKLR--------QLHTHRY>G<EPEVPESAFWKKIIAYQQKLLNYFARNFYN4501
RYR3KEDKDKEEEQAEYLWTEVTKKKKRRCGQKV>E<KPEAFTANFFKGLEIYQTKLLHYLARNFYN4412
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 4532 for RYR1.