Paralogue Annotation for RYR1 residue 462

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 462
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 462

No paralogue variants have been mapped to residue 462 for RYR1.



RYR1GTALPIEGVILSLQDLIIYFEPPSEDLQHE>E<KQSKLRSLRNRQSLFQEEGMLSMVLNCIDR492
RYR2TVDLPIESVSLSLQDLIGYFHPPDEHLEHE>D<KQNRLRALKNRQNLFQEEGMINLVLECIDR504
RYR3PITLPIEEVLQTLQDLIAYFQPPEEEMRHE>D<KQNKLRSLKNRQNLFKEEGMLALVLNCIDR491
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E462Kc.1384G>A Putative BenignSIFT:
Polyphen: probably damaging