Paralogue Annotation for RYR1 residue 4624

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4624
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4624

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2H4552RSudden unexplained deathMedium5 25500949

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1GSAAGDVSGAGSGGSSGW-GLGAGEEAEGD>E<DENMVYYFLEESTGYMEPALRCLSLLHTLV4654
RYR2-----LPTRSSSENAK-VTSLDS-----SS>H<RIIAVHYVLEESSGYMEPTLRILAILHTVI4582
RYR3-----DVANLWN-------SFND-----EE>E<EEAMVFFVLQESTGYMAPTLRALAIIHTII4487
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 4624 for RYR1.