Paralogue Annotation for RYR1 residue 464

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 464
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 464

No paralogue variants have been mapped to residue 464 for RYR1.



RYR1ALPIEGVILSLQDLIIYFEPPSEDLQHEEK>Q<SKLRSLRNRQSLFQEEGMLSMVLNCIDRLN494
RYR2DLPIESVSLSLQDLIGYFHPPDEHLEHEDK>Q<NRLRALKNRQNLFQEEGMINLVLECIDRLH506
RYR3TLPIEEVLQTLQDLIAYFQPPEEEMRHEDK>Q<NKLRSLKNRQNLFKEEGMLALVLNCIDRLN493
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q464Rc.1391A>G Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype De novo mutations in NALCN cause a syndrome characterized by congenital contractures of the limbs and face, hypotonia, and developmental delay. Am J Hum Genet. 2015 96(3):462-73. doi: 10.1016/j.ajhg.2015.01.003. 25683120