Paralogue Annotation for RYR1 residue 469

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 469
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 469

No paralogue variants have been mapped to residue 469 for RYR1.



RYR1GVILSLQDLIIYFEPPSEDLQHEEKQSKLR>S<LRNRQSLFQEEGMLSMVLNCIDRLNVYTTA499
RYR2SVSLSLQDLIGYFHPPDEHLEHEDKQNRLR>A<LKNRQNLFQEEGMINLVLECIDRLHVYSSA511
RYR3EVLQTLQDLIAYFQPPEEEMRHEDKQNKLR>S<LKNRQNLFKEEGMLALVLNCIDRLNVYNSV498
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S469Tc.1406G>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging