Paralogue Annotation for RYR1 residue 4709

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4709
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4709

No paralogue variants have been mapped to residue 4709 for RYR1.



RYR1ARKLEFDGLYITEQPEDDDVKGQWDRLVLN>T<PSFPSNYWDKFVKRKVLDKHGDIYGRERIA4739
RYR2ARKLEFDGLYITEQPSEDDIKGQWDRLVIN>T<QSFPNNYWDKFVKRKVMDKYGEFYGRDRIS4667
RYR3ARKLEFDGLYITEQPSEDDIKGQWDRLVIN>T<PSFPNNYWDKFVKRKVINKYGDLYGAERIA4572
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T4709Mc.14126C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Molecular mechanisms and phenotypic variation in RYR1-related congenital myopathies. Brain. 2007 130(Pt 8):2024-36. 17483490
Other Myopathy Genotype-phenotype correlations in recessive RYR1-related myopathies. Orphanet J Rare Dis. 2013 8:117. doi: 10.1186/1750-1172-8-117. 23919265
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146
Other Myopathy Identification of Medically Actionable Secondary Findings in the 1000 Genomes. PLoS One. 2015 10(9):e0135193. doi: 10.1371/journal.pone.0135193. 26332594