Paralogue Annotation for RYR1 residue 4729

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4729
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4729

No paralogue variants have been mapped to residue 4729 for RYR1.



RYR1KGQWDRLVLNTPSFPSNYWDKFVKRKVLDK>H<GDIYGRERIAELLGMDLATLEITAHNER-K4758
RYR2KGQWDRLVINTQSFPNNYWDKFVKRKVMDK>Y<GEFYGRDRISELLGMDKAALDFSDAREKKK4687
RYR3KGQWDRLVINTPSFPNNYWDKFVKRKVINK>Y<GDLYGAERIAELLGLDKNALDFSPVEET-K4591
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H4729Pc.14186A>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Neuromuscular conditions associated with malignant hyperthermia in paediatric patients: A 25-year retrospective study. Neuromuscul Disord. 2016 26(3):201-6. doi: 10.1016/j.nmd.2016.02.007. 26951757