Paralogue Annotation for RYR1 residue 473

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 473
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 473

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2R485QCardiomyopathy, hypertrophicHigh9 26656175

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1SLQDLIIYFEPPSEDLQHEEKQSKLRSLRN>R<QSLFQEEGMLSMVLNCIDRLNVYTTAAHFA503
RYR2SLQDLIGYFHPPDEHLEHEDKQNRLRALKN>R<QNLFQEEGMINLVLECIDRLHVYSSAAHFA515
RYR3TLQDLIAYFQPPEEEMRHEDKQNKLRSLKN>R<QNLFKEEGMLALVLNCIDRLNVYNSVAHFA502
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R473Hc.1418G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging