Paralogue Annotation for RYR1 residue 4808

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4808
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4808

No paralogue variants have been mapped to residue 4808 for RYR1.



RYR1IWKFGVIFTDNSFLYLGWYMVMSLLGHYNN>F<FFAAHLLDIAMGVKTLRTILSSVTHNGKQL4838
RYR2MWKLGVVFTDNSFLYLAWYMTMSVLGHYNN>F<FFAAHLLDIAMGFKTLRTILSSVTHNGKQL4767
RYR3IWKLGVVFTDNSFLYLAWYTTMSVLGHYNN>F<FFAAHLLDIAMGFKTLRTILSSVTHNGKQL4670
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F4808Ic.14422T>A Putative BenignSIFT:
Polyphen: benign
p.F4808Yc.14423T>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Congenital myopathies--clinical features and frequency of individual subtypes diagnosed over a 5-year period in the United Kingdom. Neuromuscul Disord. 2013 23(3):195-205. doi: 10.1016/j.nmd.2013.01.004. 23394784
p.F4808Lc.14424C>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Novel excitation-contraction uncoupled RYR1 mutations in patients with central core disease. Neuromuscul Disord. 2013 23(2):120-32. doi: 10.1016/j.nmd.2012.08.007. 23183335