Paralogue Annotation for RYR1 residue 485

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 485
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 485

No paralogue variants have been mapped to residue 485 for RYR1.



RYR1SEDLQHEEKQSKLRSLRNRQSLFQEEGMLS>M<VLNCIDRLNVYTTAAHFAEFAGEEAAESWK515
RYR2DEHLEHEDKQNRLRALKNRQNLFQEEGMIN>L<VLECIDRLHVYSSAAHFADVAGREAGESWK527
RYR3EEEMRHEDKQNKLRSLKNRQNLFKEEGMLA>L<VLNCIDRLNVYNSVAHFAGIAREESGMAWK514
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M485Vc.1453A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RyR1 deficiency in congenital myopathies disrupts excitation-contraction coupling. Hum Mutat. 2013 34(7):986-96. doi: 10.1002/humu.22326. 23553787
Other Myopathy Using exome data to identify malignant hyperthermia susceptibility mutations. Anesthesiology. 2013 119(5):1043-53. doi: 10.1097/ALN.0b013e3182a8a8e7. 24195946
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381
Other Myopathy Identification of Medically Actionable Secondary Findings in the 1000 Genomes. PLoS One. 2015 10(9):e0135193. doi: 10.1371/journal.pone.0135193. 26332594