Paralogue Annotation for RYR1 residue 4850

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4850
Reference Amino Acid: Y - Tyrosine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4850

No paralogue variants have been mapped to residue 4850 for RYR1.



RYR1GVKTLRTILSSVTHNGKQLVMTVGLLAVVV>Y<LYTVVAFNFFRKFYNKSEDEDEPDMKCDDM4880
RYR2GFKTLRTILSSVTHNGKQLVLTVGLLAVVV>Y<LYTVVAFNFFRKFYNKSEDGDTPDMKCDDM4809
RYR3GFKTLRTILSSVTHNGKQLVLTVGLLAVVV>Y<LYTVVAFNFFRKFYNKSEDDDEPDMKCDDM4712
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y4850Cc.14549A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Severe congenital RYR1-associated myopathy: the expanding clinicopathologic and genetic spectrum. Neurology. 2013 80(17):1584-9. doi: 10.1212/WNL.0b013e3182900380. 23553484