Paralogue Annotation for RYR1 residue 4853

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4853
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4853

No paralogue variants have been mapped to residue 4853 for RYR1.



RYR1TLRTILSSVTHNGKQLVMTVGLLAVVVYLY>T<VVAFNFFRKFYNKSEDEDEPDMKCDDMMTC4883
RYR2TLRTILSSVTHNGKQLVLTVGLLAVVVYLY>T<VVAFNFFRKFYNKSEDGDTPDMKCDDMLTC4812
RYR3TLRTILSSVTHNGKQLVLTVGLLAVVVYLY>T<VVAFNFFRKFYNKSEDDDEPDMKCDDMMTC4715
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T4853Ic.14558C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy [Malignant hyperthermia--a hereditary and potentially life-threatening condition]. Tidsskr Nor Laegeforen. 2005 125(20):2792-4. 16244682
Other Myopathy Congenital myopathies--clinical features and frequency of individual subtypes diagnosed over a 5-year period in the United Kingdom. Neuromuscul Disord. 2013 23(3):195-205. doi: 10.1016/j.nmd.2013.01.004. 23394784