Paralogue Annotation for RYR1 residue 4862

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4862
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4862

No paralogue variants have been mapped to residue 4862 for RYR1.



RYR1THNGKQLVMTVGLLAVVVYLYTVVAFNFFR>K<FYNKSEDEDEPDMKCDDMMTCYLFHMYVGV4892
RYR2THNGKQLVLTVGLLAVVVYLYTVVAFNFFR>K<FYNKSEDGDTPDMKCDDMLTCYMFHMYVGV4821
RYR3THNGKQLVLTVGLLAVVVYLYTVVAFNFFR>K<FYNKSEDDDEPDMKCDDMMTCYLFHMYVGV4724
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K4862Ec.14584A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Expanding genotype/phenotype of neuromuscular diseases by comprehensive target capture/NGS. Neurol Genet. 2015 1(2):e14. doi: 10.1212/NXG.0000000000000015. eColl 27066551