Paralogue Annotation for RYR1 residue 4870

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4870
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4870

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR3D4702NEpileptic encephalopathyMedium9 25262651

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1MTVGLLAVVVYLYTVVAFNFFRKFYNKSED>E<DEPDMKCDDMMTCYLFHMYVGVRAGGGIGD4900
RYR2LTVGLLAVVVYLYTVVAFNFFRKFYNKSED>G<DTPDMKCDDMLTCYMFHMYVGVRAGGGIGD4829
RYR3LTVGLLAVVVYLYTVVAFNFFRKFYNKSED>D<DEPDMKCDDMMTCYLFHMYVGVRAGGGIGD4732
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 4870 for RYR1.