Paralogue Annotation for RYR1 residue 4908

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4908
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4908

No paralogue variants have been mapped to residue 4908 for RYR1.



RYR1DDMMTCYLFHMYVGVRAGGGIGDEIEDPAG>D<EYELYRVVFDITFFFFVIVILLAIIQGLII4938
RYR2DDMLTCYMFHMYVGVRAGGGIGDEIEDPAG>D<EYEIYRIIFDITFFFFVIVILLAIIQGLII4867
RYR3DDMMTCYLFHMYVGVRAGGGIGDEIEDPAG>D<PYEMYRIVFDITFFFFVIVILLAIIQGLII4770
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D4908Gc.14723A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145