Paralogue Annotation for RYR1 residue 4911

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4911
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4911

No paralogue variants have been mapped to residue 4911 for RYR1.



RYR1MTCYLFHMYVGVRAGGGIGDEIEDPAGDEY>E<LYRVVFDITFFFFVIVILLAIIQGLIIDAF4941
RYR2LTCYMFHMYVGVRAGGGIGDEIEDPAGDEY>E<IYRIIFDITFFFFVIVILLAIIQGLIIDAF4870
RYR3MTCYLFHMYVGVRAGGGIGDEIEDPAGDPY>E<MYRIVFDITFFFFVIVILLAIIQGLIIDAF4773
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E4911Kc.14731G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Recessive RYR1 mutations cause unusual congenital myopathy with prominent nuclear internalization and large areas of myofibrillar disorganization. Neuropathol Appl Neurobiol. 2011 37(3):271-84. doi: 10.1111/j.1365-2990.2010.01149. 21062345