Paralogue Annotation for RYR1 residue 4914

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4914
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4914

No paralogue variants have been mapped to residue 4914 for RYR1.



RYR1YLFHMYVGVRAGGGIGDEIEDPAGDEYELY>R<VVFDITFFFFVIVILLAIIQGLIIDAFGEL4944
RYR2YMFHMYVGVRAGGGIGDEIEDPAGDEYEIY>R<IIFDITFFFFVIVILLAIIQGLIIDAFGEL4873
RYR3YLFHMYVGVRAGGGIGDEIEDPAGDPYEMY>R<IVFDITFFFFVIVILLAIIQGLIIDAFGEL4776
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4914Tc.14741G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Principal mutation hotspot for central core disease and related myopathies in the C-terminal transmembrane region of the RYR1 gene. Neuromuscul Disord. 2003 13(2):151-7. 12565913
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146
p.R4914Gc.14740A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Familial and sporadic forms of central core disease are associated with mutations in the C-terminal domain of the skeletal muscle ryanodine receptor. Hum Mol Genet. 2001 10(22):2581-92. 11709545
Other Myopathy The pore region of the skeletal muscle ryanodine receptor is a primary locus for excitation-contraction uncoupling in central core disease. J Gen Physiol. 2003 121(4):277-86. 12642598
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146