Paralogue Annotation for RYR1 residue 4922

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4922
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4922

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2F4851CVentricular tachycardia, polymorphicHigh9 16843546, 24025405
RYR2F4851LCatecholaminergic polymorphic ventricular tachycarHigh9 19398665, 24025405

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1VRAGGGIGDEIEDPAGDEYELYRVVFDITF>F<FFVIVILLAIIQGLIIDAFGELRDQQEQVK4952
RYR2VRAGGGIGDEIEDPAGDEYEIYRIIFDITF>F<FFVIVILLAIIQGLIIDAFGELRDQQEQVK4881
RYR3VRAGGGIGDEIEDPAGDPYEMYRIVFDITF>F<FFVIVILLAIIQGLIIDAFGELRDQQEQVR4784
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 4922 for RYR1.