Paralogue Annotation for RYR1 residue 493

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 493
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 493

No paralogue variants have been mapped to residue 493 for RYR1.



RYR1KQSKLRSLRNRQSLFQEEGMLSMVLNCIDR>L<NVYTTAAHFAEFAGEEAAESWKEIVNLLYE523
RYR2KQNRLRALKNRQNLFQEEGMINLVLECIDR>L<HVYSSAAHFADVAGREAGESWKSILNSLYE535
RYR3KQNKLRSLKNRQNLFKEEGMLALVLNCIDR>L<NVYNSVAHFAGIAREESGMAWKEILNLLYK522
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L493Pc.1478T>C Putative BenignSIFT: deleterious
Polyphen: probably damaging