Paralogue Annotation for RYR1 residue 4931

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4931
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4931

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2A4860GVentricular tachycardia, polymorphicHigh9 12093772, 24025405, 25775566

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1EIEDPAGDEYELYRVVFDITFFFFVIVILL>A<IIQGLIIDAFGELRDQQEQVKEDMETKCFI4961
RYR2EIEDPAGDEYEIYRIIFDITFFFFVIVILL>A<IIQGLIIDAFGELRDQQEQVKEDMETKCFI4890
RYR3EIEDPAGDPYEMYRIVFDITFFFFVIVILL>A<IIQGLIIDAFGELRDQQEQVREDMETKCFI4793
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4931Vc.14792C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging