Paralogue Annotation for RYR1 residue 4940

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4940
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4940

No paralogue variants have been mapped to residue 4940 for RYR1.



RYR1YELYRVVFDITFFFFVIVILLAIIQGLIID>A<FGELRDQQEQVKEDMETKCFICGIGSDYFD4970
RYR2YEIYRIIFDITFFFFVIVILLAIIQGLIID>A<FGELRDQQEQVKEDMETKCFICGIGNDYFD4899
RYR3YEMYRIVFDITFFFFVIVILLAIIQGLIID>A<FGELRDQQEQVREDMETKCFICGIGNDYFD4802
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4940Tc.14818G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Principal mutation hotspot for central core disease and related myopathies in the C-terminal transmembrane region of the RYR1 gene. Neuromuscul Disord. 2003 13(2):151-7. 12565913
Other Myopathy Ryanodine receptor type 1 gene variants in the malignant hyperthermia-susceptible population of the United States. Anesth Analg. 2013 116(5):1078-86. doi: 10.1213/ANE.0b013e31828a71ff. 23558838
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146