Paralogue Annotation for RYR1 residue 4942

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4942
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4942

No paralogue variants have been mapped to residue 4942 for RYR1.



RYR1LYRVVFDITFFFFVIVILLAIIQGLIIDAF>G<ELRDQQEQVKEDMETKCFICGIGSDYFDTT4972
RYR2IYRIIFDITFFFFVIVILLAIIQGLIIDAF>G<ELRDQQEQVKEDMETKCFICGIGNDYFDTV4901
RYR3MYRIVFDITFFFFVIVILLAIIQGLIIDAF>G<ELRDQQEQVREDMETKCFICGIGNDYFDTT4804
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G4942Vc.14825G>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in the RYR1 gene in Italian patients at risk for malignant hyperthermia: evidence for a cluster of novel mutations in the C-terminal region. Cell Calcium. 2002 32(3):143-51. 12208234