Paralogue | Variant | Associated Disease | Mapping Quality | Consensus | Pubmed |
---|---|---|---|---|---|
RYR2 | F4905L | Catecholaminergic polymorphic ventricular tachycar | High | 9 | 22956155 |
To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.
RYR1 | DQQEQVKEDMETKCFICGIGSDYFDTTPHG>F<ETHTLEEHNLANYMFFLMYLINKDETEHTG | 5006 |
RYR2 | DQQEQVKEDMETKCFICGIGNDYFDTVPHG>F<ETHTLQEHNLANYLFFLMYLINKDETEHTG | 4935 |
RYR3 | DQQEQVREDMETKCFICGIGNDYFDTTPHG>F<ETHTLQEHNLANYLFFLMYLINKDETEHTG | 4838 |
cons | > < |
Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
---|---|---|---|---|---|
p.F4976L | c.14928C>A | Putative Benign | rs368874586 | SIFT: deleterious Polyphen: | |
p.F4976L | c.14928C>G | Other Myopathy | SIFT: Polyphen: | ||
Reports | Other Myopathy | Neurofibromatosis type 1 (NF1) with an unusually severe phenotype due to digeny for NF1 and ryanodine receptor 1 associated myopathy. Eur J Pediatr. 2014 24706162 | |||
Other Myopathy | A diagnostic dilemma in a family with cystinuria type B resolved by muscle magnetic resonance. Pediatr Neurol. 2015 52(5):548-51. doi: 10.1016/j.pediatrneurol.2015.01 25882082 | ||||
Other Myopathy | Enhanced utility of family-centered diagnostic exome sequencing with inheritance model-based analysis: results from 500 unselected families with undiagnosed genetic conditions. Genet Med. 2015 17(7):578-86. doi: 10.1038/gim.2014.154. 25356970 |