Paralogue Annotation for RYR1 residue 539

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 539
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 539

No paralogue variants have been mapped to residue 539 for RYR1.



RYR1EAAESWKEIVNLLYELLASLIRGNRSNCAL>F<STNLDWLVSKLDRLEASSGILEVLYCVLIE569
RYR2EAGESWKSILNSLYELLAALIRGNRKNCAQ>F<SGSLDWLISRLERLEASSGILEVLHCVLVE581
RYR3ESGMAWKEILNLLYKLLAALIRGNRNNCAQ>F<SNNLDWLISKLDRLESSSGILEVLHCILTE568
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F539Lc.1615T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Identification of genetic mutations in Australian malignant hyperthermia families using sequencing of RYR1 hotspots. Anaesth Intensive Care. 2008 36(3):391-403. 18564801