Paralogue Annotation for RYR1 residue 585

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 585
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 585

No paralogue variants have been mapped to residue 585 for RYR1.



RYR1ASSGILEVLYCVLIESPEVLNIIQENHIKS>I<ISLLDKHGRNHKVLDVLCSLCVCNGVAVRS615
RYR2ASSGILEVLHCVLVESPEALNIIKEGHIKS>I<ISLLDKHGRNHKVLDVLCSLCVCHGVAVRS627
RYR3SSSGILEVLHCILTESPEALNLIAEGHIKS>I<ISLLDKHGRNHKVLDILCSLCLCNGVAVRA614
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I585Vc.1753A>G Putative BenignSIFT:
Polyphen: probably damaging