Paralogue Annotation for RYR1 residue 594

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 594
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 594

No paralogue variants have been mapped to residue 594 for RYR1.



RYR1YCVLIESPEVLNIIQENHIKSIISLLDKHG>R<NHKVLDVLCSLCVCNGVAVRSNQDLITENL624
RYR2HCVLVESPEALNIIKEGHIKSIISLLDKHG>R<NHKVLDVLCSLCVCHGVAVRSNQHLICDNL636
RYR3HCILTESPEALNLIAEGHIKSIISLLDKHG>R<NHKVLDILCSLCLCNGVAVRANQNLICDNL623
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R594Kc.1781G>A Putative BenignSIFT:
Polyphen: probably damaging