Paralogue Annotation for RYR1 residue 64

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 64
Reference Amino Acid: C - Cysteine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 64

No paralogue variants have been mapped to residue 64 for RYR1.



RYR1LCLAAEGFGNRLCFLEPTSNAQNVPPDLAI>C<CFVLEQSLSVRALQEMLANTVEAG--V---89
RYR2LCLAAEGFGNRLCFLESTSNSKNVPPDLSI>C<TFVLEQSLSVRALQEMLANTVEKSEGQVDV95
RYR3FCLAAEGLGNRLCFLEPTSEAKYIPPDLCV>C<NFVLEQSLSVRALQEMLANTGENG-GE---92
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C64Rc.190T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Ryanodine receptor type 1 gene mutations found in the Canadian malignant hyperthermia population. Can J Anaesth. 2011 58(6):504-13. 21455645