Paralogue Annotation for RYR1 residue 651

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 651
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 651

No paralogue variants have been mapped to residue 651 for RYR1.



RYR1TENLLPGRELLLQTNLINYVTSIRPNIFVG>R<AEGTTQYSKWYFEVMVDEVTPFLTAQATHL681
RYR2CDNLLPGRDLLLQTRLVNHVSSMRPNIFLG>V<SEGSAQYKKWYYELMVDHTEPFVTAEATHL693
RYR3CDNLLPRRNLLLQTRLINDVTSIRPNIFLG>V<AEGSAQYKKWYFELIIDQVDPFLTAEPTHL680
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R651Qc.1952G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging