Paralogue Annotation for RYR1 residue 656

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 656
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 656

No paralogue variants have been mapped to residue 656 for RYR1.



RYR1PGRELLLQTNLINYVTSIRPNIFVGRAEGT>T<QYSKWYFEVMVDEVTPFLTAQATHLRVGWA686
RYR2PGRDLLLQTRLVNHVSSMRPNIFLGVSEGS>A<QYKKWYYELMVDHTEPFVTAEATHLRVGWA698
RYR3PRRNLLLQTRLINDVTSIRPNIFLGVAEGS>A<QYKKWYFELIIDQVDPFLTAEPTHLRVGWA685
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T656Mc.1967C>T Putative BenignSIFT:
Polyphen: probably damaging