Paralogue Annotation for RYR1 residue 706

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 706
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 706

No paralogue variants have been mapped to residue 706 for RYR1.



RYR1AQATHLRVGWALTEGYTPYPGAGEGWGGNG>V<GDDLYSYGFDGLHLWTGHVARPVTSPGQHL736
RYR2AEATHLRVGWASTEGYSPYPGGGEEWGGNG>V<GDDLFSYGFDGLHLWSGCIARTVSSPNQHL748
RYR3AEPTHLRVGWASSSGYAPYPGGGEGWGGNG>V<GDDLYSYGFDGLHLWSGRIPRAVASINQHL735
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V706Ic.2116G>A Putative BenignSIFT:
Polyphen: probably damaging