Paralogue Annotation for RYR1 residue 714

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 714
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 714

No paralogue variants have been mapped to residue 714 for RYR1.



RYR1GWALTEGYTPYPGAGEGWGGNGVGDDLYSY>G<FDGLHLWTGHVARPVTSPGQHLLAPEDVIS744
RYR2GWASTEGYSPYPGGGEEWGGNGVGDDLFSY>G<FDGLHLWSGCIARTVSSPNQHLLRTDDVIS756
RYR3GWASSSGYAPYPGGGEGWGGNGVGDDLYSY>G<FDGLHLWSGRIPRAVASINQHLLRSDDVVS743
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G714Sc.2140G>A Putative BenignSIFT: tolerated
Polyphen: probably damaging