Paralogue Annotation for RYR1 residue 722

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 722
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 722

No paralogue variants have been mapped to residue 722 for RYR1.



RYR1TPYPGAGEGWGGNGVGDDLYSYGFDGLHLW>T<GHVARPVTSPGQHLLAPEDVISCCLDLSVP752
RYR2SPYPGGGEEWGGNGVGDDLFSYGFDGLHLW>S<GCIARTVSSPNQHLLRTDDVISCCLDLSAP764
RYR3APYPGGGEGWGGNGVGDDLYSYGFDGLHLW>S<GRIPRAVASINQHLLRSDDVVSCCLDLGVP751
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T722Ac.2164A>G UnknownSIFT:
Polyphen: benign