Paralogue Annotation for RYR1 residue 752

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 752
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 752

No paralogue variants have been mapped to residue 752 for RYR1.



RYR1TGHVARPVTSPGQHLLAPEDVISCCLDLSV>P<SISFRINGCPVQGVFESFNLDGLFFPVVSF782
RYR2SGCIARTVSSPNQHLLRTDDVISCCLDLSA>P<SISFRINGQPVQGMFENFNIDGLFFPVVSF794
RYR3SGRIPRAVASINQHLLRSDDVVSCCLDLGV>P<SISFRINGQPVQGMFENFNTDGLFFPVMSF781
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P752Lc.2255C>T Putative BenignSIFT:
Polyphen: probably damaging