Paralogue Annotation for RYR1 residue 763

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 763
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 763

No paralogue variants have been mapped to residue 763 for RYR1.



RYR1GQHLLAPEDVISCCLDLSVPSISFRINGCP>V<QGVFESFNLDGLFFPVVSFSAGVKVRFLLG793
RYR2NQHLLRTDDVISCCLDLSAPSISFRINGQP>V<QGMFENFNIDGLFFPVVSFSAGIKVRFLLG805
RYR3NQHLLRSDDVVSCCLDLGVPSISFRINGQP>V<QGMFENFNTDGLFFPVMSFSAGVKVRFLMG792
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V763Lc.2287G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging
p.V763Mc.2287G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Utility of next generation sequencing in genetic diagnosis of early onset neuromuscular disorders. J Med Genet. 2015 52(3):208-16. doi: 10.1136/jmedgenet-2014-102819. 25635128