Paralogue Annotation for RYR1 residue 789

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 789
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 789

No paralogue variants have been mapped to residue 789 for RYR1.



RYR1NGCPVQGVFESFNLDGLFFPVVSFSAGVKV>R<FLLGGRHGEFKFLPPPGYAPCHEAVLPRER819
RYR2NGQPVQGMFENFNIDGLFFPVVSFSAGIKV>R<FLLGGRHGEFKFLPPPGYAPCYEAVLPKEK831
RYR3NGQPVQGMFENFNTDGLFFPVMSFSAGVKV>R<FLMGGRHGEFKFLPPSGYAPCYEALLPKEK818
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R789Lc.2366G>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Clinical and genetic findings in a large cohort of patients with ryanodine receptor 1 gene-associated myopathies. Hum Mutat. 2012 33(6):981-8. doi: 10.1002/humu.22056. 22473935
p.R789Qc.2366G>A Putative BenignSIFT:
Polyphen: probably damaging
p.R789Wc.2365C>T Putative BenignSIFT:
Polyphen: