Paralogue Annotation for RYR1 residue 795

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 795
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 795

No paralogue variants have been mapped to residue 795 for RYR1.



RYR1GVFESFNLDGLFFPVVSFSAGVKVRFLLGG>R<HGEFKFLPPPGYAPCHEAVLPRERLHLEPI825
RYR2GMFENFNIDGLFFPVVSFSAGIKVRFLLGG>R<HGEFKFLPPPGYAPCYEAVLPKEKLKVEHS837
RYR3GMFENFNTDGLFFPVMSFSAGVKVRFLMGG>R<HGEFKFLPPSGYAPCYEALLPKEKMRLEPV824
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R795Hc.2384G>A Putative BenignSIFT:
Polyphen: probably damaging
p.R795Cc.2383C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging