Paralogue Annotation for RYR1 residue 803

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 803
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 803

No paralogue variants have been mapped to residue 803 for RYR1.



RYR1DGLFFPVVSFSAGVKVRFLLGGRHGEFKFL>P<PPGYAPCHEAVLPRERLHLEPIKEYRREGP833
RYR2DGLFFPVVSFSAGIKVRFLLGGRHGEFKFL>P<PPGYAPCYEAVLPKEKLKVEHSREYKQERT845
RYR3DGLFFPVMSFSAGVKVRFLMGGRHGEFKFL>P<PSGYAPCYEALLPKEKMRLEPVKEYKRDAD832
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P803Sc.2407C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging