Paralogue Annotation for RYR1 residue 844

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 844
Reference Amino Acid: C - Cysteine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 844

No paralogue variants have been mapped to residue 844 for RYR1.



RYR1VLPRERLHLEPIKEYRREGPRGPHLVGPSR>C<LSHTDFVPCPVDTVQIVLPPHLERIREKLA874
RYR2VLPKEKLKVEHSREYKQERTYTRDLLGPTV>S<LTQAAFTPIPVDTSQIVLPPHLERIREKLA886
RYR3LLPKEKMRLEPVKEYKRDADGIRDLLGTTQ>F<LSQASFIPCPVDTSQVILPPHLEKIRDRLA873
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C844Yc.2531G>A Putative BenignSIFT:
Polyphen: possibly damaging