Paralogue Annotation for RYR1 residue 845

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 845
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 845

No paralogue variants have been mapped to residue 845 for RYR1.



RYR1LPRERLHLEPIKEYRREGPRGPHLVGPSRC>L<SHTDFVPCPVDTVQIVLPPHLERIREKLAE875
RYR2LPKEKLKVEHSREYKQERTYTRDLLGPTVS>L<TQAAFTPIPVDTSQIVLPPHLERIREKLAE887
RYR3LPKEKMRLEPVKEYKRDADGIRDLLGTTQF>L<SQASFIPCPVDTSQVILPPHLEKIRDRLAE874
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L845Fc.2533C>T Putative BenignSIFT:
Polyphen: probably damaging