Paralogue Annotation for RYR1 residue 849

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 849
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 849

No paralogue variants have been mapped to residue 849 for RYR1.



RYR1RLHLEPIKEYRREGPRGPHLVGPSRCLSHT>D<FVPCPVDTVQIVLPPHLERIREKLAENIHE879
RYR2KLKVEHSREYKQERTYTRDLLGPTVSLTQA>A<FTPIPVDTSQIVLPPHLERIREKLAENIHE891
RYR3KMRLEPVKEYKRDADGIRDLLGTTQFLSQA>S<FIPCPVDTSQVILPPHLEKIRDRLAENIHE878
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D849Nc.2545G>A Putative BenignSIFT:
Polyphen: probably damaging