Paralogue Annotation for RYR1 residue 863

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 863
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 863

No paralogue variants have been mapped to residue 863 for RYR1.



RYR1PRGPHLVGPSRCLSHTDFVPCPVDTVQIVL>P<PHLERIREKLAENIHELWALTRIEQGWTYG893
RYR2TYTRDLLGPTVSLTQAAFTPIPVDTSQIVL>P<PHLERIREKLAENIHELWVMNKIELGWQYG905
RYR3DGIRDLLGTTQFLSQASFIPCPVDTSQVIL>P<PHLEKIRDRLAENIHELWGMNKIELGWTFG892
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P863Lc.2588C>T Putative BenignSIFT:
Polyphen: probably damaging