Paralogue Annotation for RYR1 residue 871

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 871
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 871

No paralogue variants have been mapped to residue 871 for RYR1.



RYR1PSRCLSHTDFVPCPVDTVQIVLPPHLERIR>E<KLAENIHELWALTRIEQGWTYGPVRDDNKR901
RYR2PTVSLTQAAFTPIPVDTSQIVLPPHLERIR>E<KLAENIHELWVMNKIELGWQYGPVRDDNKR913
RYR3TTQFLSQASFIPCPVDTSQVILPPHLEKIR>D<RLAENIHELWGMNKIELGWTFGKIRDDNKR900
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E871Kc.2611G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging