Paralogue Annotation for RYR1 residue 896

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 896
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 896

No paralogue variants have been mapped to residue 896 for RYR1.



RYR1LERIREKLAENIHELWALTRIEQGWTYGPV>R<DDNKRLHPCLVDFHSLPEPERNYNLQMSGE926
RYR2LERIREKLAENIHELWVMNKIELGWQYGPV>R<DDNKRQHPCLVEFSKLPEQERNYNLQMSLE938
RYR3LEKIRDRLAENIHELWGMNKIELGWTFGKI>R<DDNKRQHPCLVEFSKLPETEKNYNLQMSTE925
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R896Qc.2687G>A Putative BenignSIFT:
Polyphen: probably damaging
p.R896Wc.2686C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging