Paralogue Annotation for RYR1 residue 901

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 901
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 901

No paralogue variants have been mapped to residue 901 for RYR1.



RYR1EKLAENIHELWALTRIEQGWTYGPVRDDNK>R<LHPCLVDFHSLPEPERNYNLQMSGETLKTL931
RYR2EKLAENIHELWVMNKIELGWQYGPVRDDNK>R<QHPCLVEFSKLPEQERNYNLQMSLETLKTL943
RYR3DRLAENIHELWGMNKIELGWTFGKIRDDNK>R<QHPCLVEFSKLPETEKNYNLQMSTETLKTL930
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R901Gc.2701A>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging